SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020349 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020349
Domain Number 1 Region: 227-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-62
Family Eukaryotic proteases 0.000000106
Further Details:      
 
Domain Number 2 Region: 48-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-23
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000020349
Domain Number - Region: 188-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00351
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020349   Gene: ENSCPOG00000026343   Transcript: ENSCPOT00000022390
Sequence length 486
Comment pep:known scaffold:cavPor3:scaffold_107:183974:190131:1 gene:ENSCPOG00000026343 transcript:ENSCPOT00000022390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRPLAWGNYLWRNPPSSSCPGKMCWLLLWGVLQAYPTEGSVLLAWQLPQPLTSPGYPEP
YPRGQESSTDIMAPRGLAVRLVFQDFDLEPSRDCEGDSVTISGSGMLPHQLCGQQDSPFD
SPAGQREFLSSGRSLRLTFRAHSSSQEQPTHLHKGFLAVYQAVALSCQPLSQASGGSTGP
LTPGATPSDIHTYCQEPYYQAVPAGVPSCPVLGTWKDRQDQQKCPQCVPVCGRPVTPLAQ
DPGNPGPSRAPLGSFPWQAFTVIHGRGGGALLGDRWILTAAHTIYPKDSASLRKNQSVDV
FLGHTHIDEMLRLGNYPVRRVTVHPDYRQHESHNFDGDIALLELQHSVPLGPHLLPVCLP
DTETLYRSGLWGYVSGFGVQMGWLTTELKYSRLPVAPRETCEAWLRERQRMEVFTDNMFC
VEDNTQTSSVCQGDSGSVYVVWDGHAHRWVATGIVSWGVGCGKGYGFYTKVLNYVDWIKG
VMGGRD
Download sequence
Identical sequences 10141.ENSCPOP00000020349 ENSCPOP00000020349 ENSCPOP00000020349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]