SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020940 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020940
Domain Number 1 Region: 151-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 34-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000959
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020940   Gene: ENSCPOG00000026236   Transcript: ENSCPOT00000025641
Sequence length 206
Comment pep:novel scaffold:cavPor3:scaffold_25:13362610:13393550:-1 gene:ENSCPOG00000026236 transcript:ENSCPOT00000025641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALSAADLVQLCRRTWQGDGVAAASHATSRRFYFVAPDTDCGLWMRAAAPGDRIRFQFRFF
LVYSLTQAAPEPAHNASTPGPADPCAPGSYLQLYEGPPGAPRALGPPLCGLSIPAPVASS
GPFLGLRLVTRGRQPRVDFVGEVTSFHLGPCGAYFRCQNGRCIPLSLVCDHWGMDNCGDG
SDQSSWPPASCRGPAPVPRSSGPGSA
Download sequence
Identical sequences ENSCPOP00000020940 ENSCPOP00000020940 10141.ENSCPOP00000020940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]