SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000219 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000219
Domain Number 1 Region: 48-112,149-247
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-30
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 2 Region: 253-380
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-21
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 667-799
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-19
Family Second domain of FERM 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000000219
Domain Number - Region: 568-645
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000284
Family Ubiquitin-related 0.05
Further Details:      
 
Domain Number - Region: 803-861
Classification Level Classification E-value
Superfamily PH domain-like 0.00246
Family Third domain of FERM 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000219   Gene: ENSSTOG00000000245   Transcript: ENSSTOT00000000247
Sequence length 938
Comment pep:novel scaffold:spetri2:JH393305.1:10950666:10969350:1 gene:ENSSTOG00000000245 transcript:ENSSTOT00000000247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESRIYAVATSGMQLSDVSSRSHVACCASSPPALASPVSFSGLVYKNVTVPVYTALKGRAM
QISNVPFADDSSGSDDDCSSQASFRISVPCSECRKTSGLGSPRAIKRGVSMSSLSSEGDY
AIPPDACSLDSDYSEPEHKLQRTSSYSTDGLGLGGSGYLLKMGSRVKTWKRRWFVLRQGQ
ILYYKSPSDVIRKPQGQVDLNSHCQIVRGEGAQTFQLISEKKTYYLTADSPSLLEEWIRV
LQNLLKVQATGPPALPQGGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRSHEDKRPL
GRLPVRDARIEEVDRSCDSDEDYEAGGTRRLLSSHCTLVIHPPEHSPTYLLIGTKHEKDT
WLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLCTSLTTLPS
EALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMKQTS
CRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRNETGQYATYCQRAVER
TLQSGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTVDEFLQRL
NQETGMRKSSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQALKELHPGKSEGGTR
VVKLIYKNRLYFRSQVKGETERERLLLAFQTSGEIVAGRFPVNKELALEMAALMAQVEYG
DLEKPTLPGPGSTPPAKTQHLLQQVLDRFYPRRYRHGAPPEQLRHLIDMLTTKWAALQGC
SPPECIRIYLTVARKWPLFGAKLFAAQPAKLSSKENTLVWIAVNEDGVSILDHHTMQVHI
TYPYSSVTTFGGYRDDFMLVIRTIPDQGSGKAHIEKLIFRMTAPKIAETTFIMASYMNHC
STTVNPPANSPAARQPWELDGRQFFASVSCATKGPTLL
Download sequence
Identical sequences ENSSTOP00000000219 ENSSTOP00000000219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]