SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000979 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000979
Domain Number 1 Region: 394-536
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 288-395
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-32
Family Second domain of FERM 0.00000518
Further Details:      
 
Domain Number 3 Region: 208-287
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-25
Family First domain of FERM 0.0000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000979   Gene: ENSSTOG00000001085   Transcript: ENSSTOT00000001097
Sequence length 996
Comment pep:novel scaffold:spetri2:JH393600.1:486037:572974:1 gene:ENSSTOG00000001085 transcript:ENSSTOT00000001097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKDSDQLGADVTKEKAKQVAENQQHQSSEPEEEKGSQPPPPAESQSSPH
RQKREKDTSESRGISRFIPPWLKKQKSYNLVVAKDGGDKKEPTEAVVEEQILDKEVSLPE
EERQAKGDAEETAQSKHQEVKVEVKEGKPSVSKAETQPAEEVREEREEVKEIQEDEVAAP
RETKEVQTNELKAEKTSQKATKKTKTVQCKVTLLDGTEYSCDLEKRAKGQVLIDKVCEHL
NLLEKDYFGLLFQENTEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRY
FLCLQLRKDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHSSIDLSDFQFAPTQTKEL
EEKVAELHKTHSLRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLL
IYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCV
EHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASILIDRPAPHFDRTSSKRVSR
SLDGAPIGVVDQSLIKDFPGPAGGISAYGPGVVSTAMVQDRDSRRDVRSPSKAPHLQLIE
GKKNSLRVEGDNIYVRHSNLMLEDLDKAQEDILKHQASISELKRNFMESTPEPRPNEWEK
RRITPLSLQTQGSSHETLNVVEEKKQAEVGKDERVITEEMNGKEISPGSGPGEIRKVEPV
TQKDSTSLSSESSSSSESEEEDVGEYRPHHHVTEGTLREEQEEYEEETEEEPSGAAKVVE
REEAVPEASPGRQAGASVITVETVAQENVVAQKISAEKSINEGTVKQDMGEETEEEQHKV
NGEVSHVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESP
QIDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHD
QALAQAIREAKEQHPDMSVTRVVVHKETELAEEGEE
Download sequence
Identical sequences ENSSTOP00000000979 ENSSTOP00000000979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]