SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001292 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001292
Domain Number 1 Region: 596-660,698-796
Classification Level Classification E-value
Superfamily PH domain-like 2.54e-31
Family Pleckstrin-homology domain (PH domain) 0.0081
Further Details:      
 
Domain Number 2 Region: 802-920
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-20
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 1214-1347
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-19
Family Second domain of FERM 0.0041
Further Details:      
 
Domain Number 4 Region: 22-120,703-723
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000795
Family BAR domain 0.066
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000001292
Domain Number - Region: 1116-1195
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000282
Family First domain of FERM 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001292   Gene: ENSSTOG00000001436   Transcript: ENSSTOT00000001440
Sequence length 1491
Comment pep:novel scaffold:spetri2:JH393318.1:8155281:8261469:-1 gene:ENSSTOG00000001436 transcript:ENSSTOT00000001440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPSDPEGPIDWKERCAALESQLMKFRVQASKIRELLADKMQQLERQVIDAERQAEKAF
QQVQVMEQKLKAANIQTSESETRLYKKCQDLESLLQEKDDIIQNLELQFEEQKQIRIQEA
KIIEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIKALQSKLQEVQGKKSSMVSTP
KLSEGQRLSNLKFGCFLSRAKSPPQVVKSEEMSKISSKESESTEGKKTEEMEILEKSVDN
PVQENERGQRTLHKTPCVSEQNRKTRVSFAMDDNVCKNSEAPGSDWSSDEEDENKETSKS
RSMTRLSSHTSEEGVPCGRIGSEAYLTASDDSSSVFEEETFGVKRPEHKKLYSWQQEAQW
KAHNNLLGKGNSESSKKEHDSEELNKKFQSQRLDYSSSSSETNTPSPILTPSLTPKHSNT
LTGKGTQLVCSSHLSPSRLRIPNVFSISVALTKRHLSQPQLSSDRTFGTNRNAISMIRPL
RPQETDLDLVDGDSPEILENMDTSCEDGLFCSDSMESTHPDEQETCDSAKKAAGGKPPTP
PLHRFPSWESRIYAVAKSGIRMSEAFNMENVNKNSATMLSYTTSGLYTSLIYKNMTTPVY
TTLKGKATQISSSPFLDDSSGSEEEDGSRSSSQTSESDSRNRSGPGSPRAMKRGVSVSSV
ASENDYAIPPDAYSADTECLQPEQKLPKTCSTSSDNGKNEPLEKSGYLLKMSGKVKTWKR
RWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTTEKHTYYLTADSP
NILEEWIKVLQNVLRIQAANPLFLQPEGKPTMKGLLTKVKHGYSKRVWCTLIGKTLYYFR
SQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLLIG
SKHEKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIEGESSSQIWRHPTLCHSKEGILS
PLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEICC
QLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLGLHLKRNADSRTEFGKYAI
YCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDASTT
VEEFLNTLNQDTGMRKPLQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQQP
GKCEGTRTVRLTYKNRLYFSMQARGETDREKLLLMYQTNDQIVNGLFPVSKDLALEMAAL
LAQVEIGDFERPFSTPAGQVTNQCKANQTLKQVIEKFYPKGYRDGCSEEQLRQLYQRLST
RWMALRGHNAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGNAFMWLAIHENGLSILE
YNSMRLIVSYVYKSLMTFGGFQDDFMVVINNTHSKDKSTEKLLFAMAKPKILEITLLIAS
YINNFHQQKAAFHHLSAPALLSSRTQGPQARAMGSQLLLPSSRPTKGPTLL
Download sequence
Identical sequences I3LYL1
XP_005324578.1.77405 ENSSTOP00000001292 ENSSTOP00000001292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]