SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001551 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001551
Domain Number 1 Region: 93-235
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-39
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 2-95
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-23
Family Second domain of FERM 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001551   Gene: ENSSTOG00000001735   Transcript: ENSSTOT00000001737
Sequence length 622
Comment pep:novel scaffold:spetri2:JH393501.1:2736160:2755980:1 gene:ENSSTOG00000001735 transcript:ENSSTOT00000001737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCRYLFTLQIKKDLALGRLPCSDNCTALMVSHILQSELGDFHEETVKKHLAQSRYLPNQD
CLESKIMHFHQKHIGKNPAESDILLLDIARKLDMYGIRPHPASDGEGMQIHLAVAHMGVL
VLRGNTKINTFNWAKIRKLSFKRKHFLIKLHANILALCKDTLEFTMASRDACKAFWKTCV
EYHAFFRLSEEPKSKPKTLLCSKGSSFRYSGRTQRQLLEYGNKRQLKSLPFERKHYPSQY
HERQCRSSPDILSDVSKQVEDLRLAYGGGYYRNVNGVHASEPVLDSRRRNSAVEVTFAAE
LERSKPEADPTSLHQSQSSSSFSFLYSDPVFNTDPDPQPDPRDFFEQRSPLSSFRTSSKF
ADHHINTSSGLTSGVSPARQLTYTDVPYIPCTSQQVDIMPPQVFFYVDKPPQVPRRSPVM
AEERARPDNYLEPSAIKPPKRSPRNTRIKSFQQDLQELQEAMARTSGRNNINLDPEEEDP
NLEDAFTYNIQEQTPKRSQSQSDMKTIRFPFGSEFRPLGPRPALSRKADLFTCMFAEQEF
PAVLMDQSTAERYVASESSDSESEILKPDYYSLYGKGKKSPMARIRLSSGSLQLDEEDED
VSFNTPSAEDRTLLKPCNYFLA
Download sequence
Identical sequences ENSSTOP00000001551 ENSSTOP00000001551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]