SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002215 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002215
Domain Number 1 Region: 11-163
Classification Level Classification E-value
Superfamily EF-hand 3.84e-43
Family Calmodulin-like 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002215   Gene: ENSSTOG00000002483   Transcript: ENSSTOT00000002477
Sequence length 179
Comment pep:novel scaffold:spetri2:JH393334.1:9742748:9743300:-1 gene:ENSSTOG00000002483 transcript:ENSSTOT00000002477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEASYPKEMCSHFEPEEIKRLGRSFKKLDFDKSGALSVNEFMSLPELQQNPLVKRVID
IFDTDGNGEVDFTEFIRGTSQFSVKGDEEQKLMFAFRIYDVDKDGYISNGELFQVLKMMV
GNNLKDWQLQQLVDKTIIIMDKDGDGKLSFEEFSAVVRDLEVHKKLIVTVEHGPNNFAQ
Download sequence
Identical sequences ENSSTOP00000002215 ENSSTOP00000002215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]