SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002938 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002938
Domain Number 1 Region: 42-183
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-24
Family Third domain of FERM 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000002938
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000852
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002938   Gene: ENSSTOG00000003275   Transcript: ENSSTOT00000003287
Sequence length 436
Comment pep:novel scaffold:spetri2:JH393305.1:13973115:13992082:-1 gene:ENSSTOG00000003275 transcript:ENSSTOT00000003287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSKRGKDYILKHIPNMHKDQFALTASEAYLKYIKEAVRLDDVAVHYYRLYKDKREIEAS
LTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIYYTGC
PMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDNLDLDMDQLEKRS
RASGSSAGSVKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRKLKTCSS
MTSHGSSHTSGVESGGKDRLEEDSQDDEIEMLVDDPRDLEPMNEESLEVSPDMCIYITED
MLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTVCRKPKTSSDRHSLSLD
DIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCVNIQDAFPVKRTSK
YFSLDLTHDEVPEFVV
Download sequence
Identical sequences ENSSTOP00000002938 ENSSTOP00000002938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]