SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002949 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002949
Domain Number 1 Region: 906-1189
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-70
Family Protein kinases, catalytic subunit 0.00000637
Further Details:      
 
Domain Number 2 Region: 600-904
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.63e-42
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 3 Region: 471-578,607-633
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000477
Family SH2 domain 0.0081
Further Details:      
 
Domain Number 4 Region: 396-460
Classification Level Classification E-value
Superfamily PH domain-like 0.000000602
Family Third domain of FERM 0.025
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000002949
Domain Number - Region: 207-292
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000324
Family Second domain of FERM 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002949   Gene: ENSSTOG00000003264   Transcript: ENSSTOT00000003298
Sequence length 1209
Comment pep:novel scaffold:spetri2:JH393469.1:682339:702800:-1 gene:ENSSTOG00000003264 transcript:ENSSTOT00000003298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSMPLCQKGAAAKGSKPHRDRAQPMADMGGLKVLLHWAGPRGGEPWVTFSKTSLTAEEV
CIHIAHKVGITPPCFNLFALFDAQAQVWLPPNHILEVSRDTSLTLYFRMRFYFRNWHGMN
PQEPAVYRCGLPGAETSSEPTEQGVQLLDPASFEYLFEQVFLSLGNEIILILPFLPDSYS
QGKHEFVNDVVSLWELSSEEEIHHFKNESLGMAFLHLSHLALQRGVPLEEVAKEISFKDC
IPLSFRQQIRQHNALTRLRLRNVFRKFLHAFQPGHLSQQMVMVKYIATLEHLAPRFGTER
IPVCHLELLSQAEGEPCYIQDSRRASADHNLEPALGSPTHEVLVTGTGGIQWRPVQVEVS
SDVNDSSRNSQTHLSGKKAKAREAGGQPANRPREPPWTYFCDFQDITHLVLKGCRVTIYQ
QDNKCLELRLPSRAAALSFVALVDGYFRLTADSSHYLCQEVAPPRLVMSIQEGIHGPLLE
PFVQAKLQPEEGLYLIHWSTVHLHRLILTVAQPEPVGLELGVQSLRIRKFPIEQQDGAFM
LEGWGRSFASVQELRGALQGCSLRAGDDCFSLRRCCLPQPGEISNLIIMRGSRASSRPLN
LSQLSFHRIHQDEITQLSHLGQGTRTNVYEGLLRVGGPEEGKADGGDSPKPGGGCGQQLR
VVLKVLDPSHHDIALAFYETASLMSQVSHAHLAFVHGVCVRGSENIMVTEYVENGPLDVW
LRREKGHVPMTWKVAVAQQLASALSYLEDKNLVHGNVCGRNILLARLGLAEGTSPFIKLS
DPGVGLGALSREERVERIPWTAPECLPAGATSLCTAADKWGFGATLLEICFDGEAPLQGR
GPSEKERFYQKQHRLPEPSCPELATITSQCLTYERALRPSFRTILRDLTQLQPHDLVDVS
TINPDSPVSDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGP
QLRSGWRREIDILRTLYHEHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHNVGLA
QLLLFSQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVR
EDGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSSQSPPSKFLELIGLTQGQ
ITVLRLTELLERGERLPRPERCPCEIYHLMKNCWEAESSFRPTFQNLIPILKMVHEKYQG
QAPSVFSVC
Download sequence
Identical sequences ENSSTOP00000002949 ENSSTOP00000002949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]