SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003354 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003354
Domain Number 1 Region: 91-198
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000932
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 508-571,623-654
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000192
Family Second domain of FERM 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000003354
Domain Number - Region: 400-495
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000238
Family First domain of FERM 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003354   Gene: ENSSTOG00000003732   Transcript: ENSSTOT00000003743
Sequence length 794
Comment pep:novel scaffold:spetri2:JH393300.1:17398951:17407380:-1 gene:ENSSTOG00000003732 transcript:ENSSTOT00000003743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGGLWWLLCCRRGFTLLHRDYGDGELSGDGDEDEDEETFELRTPSPAGGGRSPLDVT
LTQPVRSAAVSDRLQSWEETWSLIPEKGLPEDDPDIVVKGWLYREPRGGGARPWLPPRRA
WFVLTRDSLDHFSSNGKGARRLGSLVLTSLCSVTGPERRPKETGLWSVTVSGRKHSVRLC
SPRQAEAERWGVALREVISSKAPLETPTQLLLRDIQESCGDPEAVALIYRRNPILRHTSG
ALYAPLLPLPYGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPAL
RDELFLQLAKQTSGPAGPPGLPATQDPATLRYWQLLTCMSCTFRPGGAVRGHLLGHLERT
EQALPDSELAEYARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACSVAI
DSHTTAGEVARELVGRLGLARSRNVFALYEQRGAQERALAGGTLVADVLTRFENLASEEA
GLEDSLDSGWRLCLRLHGPLHPEGLSPDGHELPFLFEQAHALLLRGRPPPPDDTLRALAA
LRLQSLHRDFSPRVPLPRLDRLLPPPIPPCEVQPRPTPRPPPSAALLAGALWSPSLAKRQ
AERARRSGACRTAGSAAPEGGGGGARTAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPGF
GAARYDVLELSTEPGGGAPQKLCLGLGAKTMSLSRPGETEPIHSVSYGHVAACQLMGPQT
LALRVGESQLLLQSPQVEEIMQLVNAYLANPSPERPCGSSAPPCQDLPDTSPPSQHQGLD
EPQGQSGFLGQLQD
Download sequence
Identical sequences ENSSTOP00000003354 ENSSTOP00000003354 XP_005321945.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]