SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004370 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004370
Domain Number 1 Region: 7-758
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.24e-269
Family Motor proteins 0.000000000152
Further Details:      
 
Domain Number 2 Region: 1178-1274
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-28
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1357-1471
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1760-1829,1872-1916
Classification Level Classification E-value
Superfamily Second domain of FERM 1.04e-17
Family Second domain of FERM 0.0082
Further Details:      
 
Domain Number 5 Region: 1295-1349
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000218
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1134-1178
Classification Level Classification E-value
Superfamily PH domain-like 0.0000121
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 7 Region: 780-891,1180-1205
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000439
Family Arfaptin, Rac-binding fragment 0.06
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000004370
Domain Number - Region: 1667-1753
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00551
Family Ras-binding domain, RBD 0.019
Further Details:      
 
Domain Number - Region: 1920-2006
Classification Level Classification E-value
Superfamily PH domain-like 0.0486
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004370   Gene: ENSSTOG00000004826   Transcript: ENSSTOT00000004875
Sequence length 2024
Comment pep:novel scaffold:spetri2:JH393290.1:19282085:19406742:-1 gene:ENSSTOG00000004826 transcript:ENSSTOT00000004875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFTYKQSTITQQKVTPMHPLNEEGVDDMAALSELHGGSIMYNLFQRYKRNQIYTYIGSI
IASVNPYQPIAGLYEYATMEQYSRHHLGELPPHIFAIANECYRCLWKRHDNQCVLISGES
GAGKTESTKLILKFLSVISQQSLELSLKEKTSCVEQAILESSPIMEAFGNAKTVYNNNSS
RFGKFVQLNICQKGNIQGGRIVDYLLEKNRVVRQNPGERNYHIFYALLAGLEHAERVEEF
YLSVPENYHYLNQSGCIEDKTISDQESFKEVITAMEVMQFSREEVREVLRLLAGILHLGN
IEFITAGGAQVSFKTALGRSAELLGLDPMQLTDALTQRSMFLRGEEILTPLNVQQAADSR
DSLAMALYSRCFEWVIKKINSRIKGKDDFKSIGILDIFGFENFEVNHFEQFNINYANEKL
QEYFNKHIFSLEQLEYSREGLVWEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDS
TLLEKLHNQHANNHFYVKPRVAVNNFGVKHYAGEVLYDVRGILEKNRDTFRDDLLNLLRE
SRFDFIYDLFEHVSSRNNQDTLKCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIK
PNMQKMPDQFDQAVVLNQLRYSGMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLPLPED
VRGKCTALLQLYDASNSEWQLGKTKVFLRESLEQKLEKQREEEVTRAAMLIRAHILGYLA
RKQYRKVLCGVVTIQKNYRAFLLRKRFLHLKKAAIVFQKQLRGQLARRVYRQLLAEKREL
EEKRKREEEAKKKQEEEERERERMRREAELRAQQEEEARKQRELAALQKSRKEAELTREL
EKQKENKQVEEILRLEKEIEDLQRMKERQELSLTQASLQKLQQLRDEELRRLEDEACRAA
QEFLESLNFDEIDECVRNIERSLSVGSEFSGELSELAENASAQKPNFNFSQPYPEEEVDE
GFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLAP
SVHDSSSGESTYCMPQNTGDLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDY
RCSVGTYNSSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSF
LYMKELPLGGTGGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNW
KKRWFVLRQSKLMYFENDSEEKLKGTLEVRTAKEIIDNTSKENGIDIIMADRTFHLIAES
PEDASQWFSVLSQVHSSTDQEIREMHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFV
IITANRVLHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLHKEVKNSPKTSSLKL
KKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHC
YRLYTKLLNEATRWSSAIQNVTDAKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILR
YTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQ
TGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRAILKYLKFHLK
RVREQFPGTEMEKYALFIYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKI
TITSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHLDKAIESRTIVADVLAKFEKLAAT
SESGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALR
LQYLQGDYSLHATIPPLEEVYSLQRLKTRISQSTKSFTPCERLEKRRTSFLEGTLRRSFR
TGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWKKFQGMNQEQAMAKYMALIKEWPGYG
STLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVV
DERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSVSSQGSSR
Download sequence
Identical sequences ENSSTOP00000004370 ENSSTOP00000004370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]