SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004644 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004644
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.12e-71
Family A middle domain of Talin 1 0.0000000351
Further Details:      
 
Domain Number 2 Region: 753-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.29e-53
Family I/LWEQ domain 0.000000231
Further Details:      
 
Domain Number 3 Region: 2295-2486
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.69e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 658-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.11e-48
Family I/LWEQ domain 0.000000481
Further Details:      
 
Domain Number 5 Region: 1841-1973
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.2e-45
Family VBS domain 0.000000549
Further Details:      
 
Domain Number 6 Region: 1225-1361
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.77e-38
Family VBS domain 0.015
Further Details:      
 
Domain Number 7 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-34
Family Second domain of FERM 0.000000558
Further Details:      
 
Domain Number 8 Region: 1075-1207
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.04e-27
Family VBS domain 0.031
Further Details:      
 
Domain Number 9 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 10 Region: 1410-1555
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000101
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 79-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000271
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 1695-1814
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000298
Family VBS domain 0.023
Further Details:      
 
Domain Number 13 Region: 2010-2132
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000011
Family VBS domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000004644
Domain Number - Region: 949-1042
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000569
Family I/LWEQ domain 0.0041
Further Details:      
 
Domain Number - Region: 1598-1658
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00228
Family VBS domain 0.078
Further Details:      
 
Domain Number - Region: 2100-2227
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0484
Family I/LWEQ domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004644   Gene: ENSSTOG00000005092   Transcript: ENSSTOT00000005175
Sequence length 2541
Comment pep:novel scaffold:spetri2:JH393334.1:3693977:3720762:-1 gene:ENSSTOG00000005092 transcript:ENSSTOT00000005175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLERDLQEVKAAARDGKLKPLP
GETMEKCAQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPTVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRTVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLATAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAIATASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVSVQEMVTKSNTSPEELGPLANQLTSDYGRLALQAKPAAVAAENEEIGAHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPNPELKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences I3M5L3
XP_005326311.1.77405 XP_021582645.1.77405 ENSSTOP00000004644 ENSSTOP00000004644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]