SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004853 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004853
Domain Number 1 Region: 70-177
Classification Level Classification E-value
Superfamily Second domain of FERM 1.19e-38
Family Second domain of FERM 0.000000716
Further Details:      
 
Domain Number 2 Region: 1-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.03e-20
Family First domain of FERM 0.0000242
Further Details:      
 
Domain Number 3 Region: 178-232
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-18
Family Third domain of FERM 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004853   Gene: ENSSTOG00000005408   Transcript: ENSSTOT00000005423
Sequence length 233
Comment pep:novel scaffold:spetri2:JH393467.1:3565768:3619831:1 gene:ENSSTOG00000005408 transcript:ENSSTOT00000005423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFL
AKFYPENAEEELVQEITQHLFFLQVKKQILEEKIYCPPEASVLLASYAVQAKYGDYDPSV
HKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMY
GVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKE
Download sequence
Identical sequences ENSSTOP00000004853 ENSSTOP00000004853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]