SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005678 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005678
Domain Number 1 Region: 217-361
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 107-216
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-38
Family Second domain of FERM 0.000000697
Further Details:      
 
Domain Number 3 Region: 517-604
Classification Level Classification E-value
Superfamily Moesin tail domain 8.24e-32
Family Moesin tail domain 0.0000271
Further Details:      
 
Domain Number 4 Region: 23-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.79e-26
Family First domain of FERM 0.00000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005678   Gene: ENSSTOG00000006325   Transcript: ENSSTOT00000006350
Sequence length 604
Comment pep:novel scaffold:spetri2:JH393299.1:10414503:10434554:-1 gene:ENSSTOG00000006325 transcript:ENSSTOT00000006350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHGASAVVRRVQSVHCFHLAFQINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREV
WYFGLQYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVSEELIQDITQKLF
FLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHK
LTRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
LGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQ
LCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMLR
EKEELMLRLQDYEQKTRRAEKELNDQIQRALQLEDERKRAQEEAERLEADRVAALRAKEE
LERQAADQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEE
LHLVMTAPPPPPPPVYEPVSYHVQESPLEEGAEPMGYSAELCSEGILDDRNEEKRITEAE
KNERVQRQLLTLSNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDE
FEAM
Download sequence
Identical sequences ENSSTOP00000005678 ENSSTOP00000005678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]