SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005939 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005939
Domain Number 1 Region: 131-275
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 2 Region: 31-133
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-28
Family Second domain of FERM 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000005939
Domain Number - Region: 1-30
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00393
Family First domain of FERM 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005939   Gene: ENSSTOG00000006605   Transcript: ENSSTOT00000006642
Sequence length 382
Comment pep:novel scaffold:spetri2:JH393282.1:11892554:11967801:-1 gene:ENSSTOG00000006605 transcript:ENSSTOT00000006642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCN
DTSAALLISHIVQSEIGDFDEALDREHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAESD
FQLLEVARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFK
RKRFLVKLRPDANSSYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFS
RGSSFRFSGRTQKQVLDYVKEGGHKKVQFERKHSKIHSIRSLATQPTEPNSEVPKQSPQS
TSLTFGEGADSPGGRSCQQGKELKVSTPESGPHQSPALKKSPAGGSKPADRATKAPPEEE
EEEEGVKERVQQSKPQPPQPST
Download sequence
Identical sequences ENSSTOP00000005939 ENSSTOP00000005939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]