SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006708 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006708
Domain Number 1 Region: 12-139
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 141-245
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-24
Family Third domain of FERM 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006708   Gene: ENSSTOG00000007490   Transcript: ENSSTOT00000007508
Sequence length 1042
Comment pep:novel scaffold:spetri2:JH393280.1:2277606:2464400:1 gene:ENSSTOG00000007490 transcript:ENSSTOT00000007508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLFRISFVPKDPIDLLRRDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYI
ATVTTKQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKL
SALQAKVHYLKFLSDLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVAL
LADFSHVNRIEMFTEEENLVRVELHVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSRR
SIFNMANKKNAGTQDTGAENKGKPNLLGPDWNCMPQMTTFIGEGEQEAQITYIDSKQKTV
EITDSTMCPKDHRHLYIDNTYNPDELNQQLTQPGDAPCEADYRSLAQRSLMSLSGPETLK
KAQESPRGAKVSFIFGDLALDDGMSPPTLGYERLLDESPEMLEKQKNLYISSANDMKNLD
LAPDTESIQFVANSVYANIGDVKNFEAPEGIEEPLLHDICYAENTDDAEDEDEVSCEEDL
VVGEMNQPAILNMSGSSDDIIDLTSLPPPEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDE
EDTQSQATSFREDKEQSSSLQNDEIPVSLIDAVPTSAEGKCEKGLDNAVVSTLEALEALS
VSEEQQTSDNSGVAILRAYSPESSSDSGNETNSSEMTESSELAAAQKQSESLSRMFLATH
EGYHPLAEEQTEFPTSKAPAGALPPKSSHSLAARPVTDLPSKVVPSKQILHSDHMEMEPE
TMETKSVTDYFSKLHMGSVVYSCTSKRKSKLAEGEGKVPTSGNMPGKKQQGTKMTEMEED
AKGKFGTVSSRDSQHLSTFNLERTAFRKDSQRWYVATEGGVTEKGGLEAAAGQAFPRASG
LGAREAEGKEEGALDGEVNDVSGLGQGDRFLTDVACVSSAKDLDNPEDADSPTCDHSSKL
PEAEEGVARLCDYHLAKRMSSLQSEGHFSLQSSQGSSVDTGCGPGSSGSACATPVESPLC
PSMGKHLIPDASGKGVSYIPSEERATGLPNHGANFKELHPQAEGMCPRMTVPALHTAINA
DPLFGTLRDGCHRLPKIKETTG
Download sequence
Identical sequences ENSSTOP00000006708 ENSSTOP00000006708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]