SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007084 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007084
Domain Number 1 Region: 584-858
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.36e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000147
Further Details:      
 
Domain Number 2 Region: 215-335
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-32
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-32
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 4 Region: 463-552
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-20
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.24e-19
Family First domain of FERM 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007084   Gene: ENSSTOG00000007885   Transcript: ENSSTOT00000007916
Sequence length 868
Comment pep:novel scaffold:spetri2:JH393369.1:3468349:3547364:1 gene:ENSSTOG00000007885 transcript:ENSSTOT00000007916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRTSELPKEKARSEVVCSIRFLDGLVQTFKVNKQDTGQSLLDMAYT
HLGVTEKEYFGLQHGGDSVDSPRWLESSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFDSSVHHPGYLADSQFIPDQ
NDDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLPQYWTLGSRNPKKRSPRLRHEIRKPRHSSADNLANEMTY
ITETEDVFYTYKGSLSPKDSDSEVSQNRSPHRESLSESNPAQSCRTQKSSSSVSPSSNAP
GSCSPDGVDQQFLEDYNRVTKGGSTEDASQYYCDKNDNGDSYLVLVRITPDEDGKFGFNL
KGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRES
HSRELALVIRRKAVHSFTEIKSEDELNQLFPETIFPMCPEGGDTLEGSMELLKKGLESGT
VLIQFEMCSRKHLVPAVTKSQLPGSSHKNSYKWILPNDTTRVLLQGNEDYINASYVNMEI
PAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVM
DHGIFHIQCQTEDCTIAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFV
TYVRSLRVDGEPILVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMREQRAMMV
QTSSQYKFVCEAILRVYEEGLVQMLDPS
Download sequence
Identical sequences ENSSTOP00000007084 ENSSTOP00000007084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]