SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008251 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008251
Domain Number 1 Region: 257-541
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-79
Family Protein kinases, catalytic subunit 0.0000000409
Further Details:      
 
Domain Number 2 Region: 704-846
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.09e-57
Family FAT domain of focal adhesion kinase 0.00000741
Further Details:      
 
Domain Number 3 Region: 101-206
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-31
Family Third domain of FERM 0.00015
Further Details:      
 
Domain Number 4 Region: 1-96
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-25
Family Second domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008251   Gene: ENSSTOG00000009205   Transcript: ENSSTOT00000009200
Sequence length 849
Comment pep:novel scaffold:spetri2:JH393485.1:296491:483801:1 gene:ENSSTOG00000009205 transcript:ENSSTOT00000009200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEPRAGPGSALPT
SPQPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELVQGWNITVDLV
IGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAE
AENMADLIDGYCRLQGEHKGSLIIHPKKDGEKRNSLPQIPTLNLEARRSHLSESCSIESD
IYAEIPDETLRRPGGPQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCK
KDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGIIEEEPTWIIMELYSYGELGHYLERNKNS
LKVPTLVLYALQICKAMAYLESINCVHRDITIRNILVASPECVKLGDFGLSRYIEDDKYY
KASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEK
GDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDIYQMEKDIAIEQERNARYR
PPKILEPIASQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPV
NSLHTPPLHRHNVFKRHSMREEDFIRPSSREEAQQLWEAEKIKMRQILDKQQKQMLEDSQ
WLRQEEKSLDPMVYMNDKSPLTPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLV
YLNVMELVRAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIE
GTQKLLNKDLADLINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVL
ANLAHPPAE
Download sequence
Identical sequences ENSSTOP00000008251 ENSSTOP00000008251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]