SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008828 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008828
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 398-503
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-22
Family Third domain of FERM 0.0061
Further Details:      
 
Domain Number 3 Region: 42-138
Classification Level Classification E-value
Superfamily PDZ domain-like 2e-16
Family PDZ domain 0.022
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000056
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008828   Gene: ENSSTOG00000009836   Transcript: ENSSTOT00000009844
Sequence length 1566
Comment pep:novel scaffold:spetri2:JH393334.1:5507252:5556988:1 gene:ENSSTOG00000009836 transcript:ENSSTOT00000009844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELETSLFQTRKAHRIEQMVARWLRRSRDSSARAKITAADVPPGNPPQALTPVRHTVKI
EKDALLQDYGFQISETLPLTVVAVTAGGSAHGKLFPGDQILQMNNETTEDLSCERAVNIL
REAEESLSITVVRCISGVPKSSFLTEEKRARLKTNPVKVHFAEEVLVSGHSQGNSLLCMP
NVLKLYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSIEYFALALEEQYNVSRLHLLHE
EELIQQVVEREELHDSRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGRIFNATLMLQDRESYIAILVGA
KYGISQIINSKLNIMSSLAEFANISRVELTEESEKVSMVRVYLQDIKVLTLLLESNSAKD
LACLIAGYYRLFVDPVTSIFLWPGNKQVHRVSAEEGYESRACSDSEESSEVDCVLEPLSD
RCLVKLSPCRMSVKEDHLLGNSPTPELARRGASTCGAGSTTDSAESEASDSANTESRGCR
TSGSSESMDALEEDDLDACSSSRSDFFRFGSSGFSEDLDSDSLEDRNRIETSGFLCLLDL
AQSASAQCQKMECSQRLASENCSWGPELSVGRLDPRLYEGSRDNYYSLCSSVSPASHLSD
SSESTTSRQGVILPAWSQQGWTEPQPSSTLEALPLRPPLAFEDGSSDEEYYDAADKLTPP
DPPAGPRAISAIEPSATGLQSKASTCTCDDGLHPRPEGIQPSRRGGAKKYARTLRKRRSF
LQTDYTSQVSFPLVPSASLESMDDVCYYDREPYLTVSAPSPTVSSLQDVQGEPGLLETKA
LGLLAPLRETKSKNPASRVMEMEPETMETKSVIDSRVCSISAIRFRIDPNNKENSEVASL
AATVDSSSESTPRGSIPGSSGPETAQSRPFQILSPFQDSNGSAPKELILELGNSTFPLSS
ANPNPDIPRPHNVSQRDSLELGGIPLAMRLGSFLTNHIQETTTQYTELLLSPGDGPRSDE
CGMNSREKATFPTKEEQLFLESDSEVTNKYDTNLFQEESRENAGGLKGDISNVVSQALDV
STADGETITSLSLEAPGTGTEQTPLHTPKDPQGQCREAQSQALRAQEQKHLAELDLDPDF
LLGKQTVLSAFAPEGVKAESLNHVIEESRALRDAPQQVCFNPSLTKPQPCQEKSHYEASN
HCSLSESKNSSPSICLPTEKSFLCFAPESHPAVSVGLGKAASLGFAGMNEEVVAPRIGME
QCSCQFSYATCFRGPQPDTEEEDRGPEAHPMAPLTSPPSAGSRMALPWRPARSHSCSTAP
LSRESHIWPEYCSRALRQLKAAPTSTPEGFIQLMENLLELQDILEASWGVGNKHPPEKCT
WYFSESRSRLCMGSQKLLSSCQHVIRMDQSPEEMQGAVCDTFQHLVQLAGLCFQFTDCSR
CSARHREAAGNLRDVVYTYHQFVEAAKLTCERGYHDLSVKLLARQCTALTAAVFCLTQKF
RASTAL
Download sequence
Identical sequences ENSSTOP00000008828 ENSSTOP00000008828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]