SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009186 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009186
Domain Number 1 Region: 168-310
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 64-169
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-37
Family Second domain of FERM 0.00000297
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-21
Family First domain of FERM 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009186   Gene: ENSSTOG00000010222   Transcript: ENSSTOT00000010238
Sequence length 319
Comment pep:novel scaffold:spetri2:JH393589.1:1021162:1099363:1 gene:ENSSTOG00000010222 transcript:ENSSTOT00000010238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSGAWQFSFNVK
FYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDECGN
DYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSE
GVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKL
PNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRASALIDRPA
PYFERSSSKRYTMSRSLDG
Download sequence
Identical sequences ENSSTOP00000009186 ENSSTOP00000009186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]