SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009266 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009266
Domain Number 1 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-17
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 2 Region: 399-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 140-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 35-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000903
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000009266
Domain Number - Region: 329-354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 357-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00127
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009266   Gene: ENSSTOG00000010323   Transcript: ENSSTOT00000010327
Sequence length 714
Comment pep:novel scaffold:spetri2:JH393532.1:1421868:1426866:-1 gene:ENSSTOG00000010323 transcript:ENSSTOT00000010327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTALPFLAFPVGGALAHPDLNIFPSPACENPPALLLEVQGTLQRPLGWDRRSSPANCTW
LILGSKEQTVTVRFQKLHLACGSERVILSSPLQPLISLCEAPSSPLQLPGGNVTITYSYA
GARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVPAAQRCDGVDACGDGSDEAGCSSDPF
PSLTPGPTPTLPCNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTAL
DLGYGDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVAYHTVAWSNGRGFN
ATYHVRGYCLPWDRPCGLGSGLGAGENLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPG
HFPCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCD
GQPDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCRLYAIRTQEYSIFAP
LSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPG
SASGGRRRQRGRSVRRLVRRLRRWGLLPRTNPSSRASETRPQVTPPVASLEALDGSPGAA
REGGAVGGQDGEQAPPLPVKSPLPSASTSPTLPSVPETQGPLPSVPLEPSVLSGVVHALR
GRLLPSLWPQGPTWTPPGPHTAVLAPEDEDDVLLMPLAEPVVWVVETEDEPLLA
Download sequence
Identical sequences ENSSTOP00000009266 ENSSTOP00000021238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]