SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010230 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010230
Domain Number 1 Region: 666-774
Classification Level Classification E-value
Superfamily Second domain of FERM 8.24e-34
Family Second domain of FERM 0.00022
Further Details:      
 
Domain Number 2 Region: 1359-1463
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-28
Family PDZ domain 0.0000235
Further Details:      
 
Domain Number 3 Region: 1073-1183
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-28
Family PDZ domain 0.0064
Further Details:      
 
Domain Number 4 Region: 776-881
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-27
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 5 Region: 1782-1871
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-22
Family PDZ domain 0.013
Further Details:      
 
Domain Number 6 Region: 1500-1604
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-20
Family PDZ domain 0.045
Further Details:      
 
Domain Number 7 Region: 1875-1966
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-17
Family PDZ domain 0.023
Further Details:      
 
Domain Number 8 Region: 572-665
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.18e-16
Family First domain of FERM 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000010230
Domain Number - Region: 2-155
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00138
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010230   Gene: ENSSTOG00000011378   Transcript: ENSSTOT00000011399
Sequence length 2111
Comment pep:novel scaffold:spetri2:JH393730.1:341847:470220:-1 gene:ENSSTOG00000011378 transcript:ENSSTOT00000011399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGSLQEEEIWAVLNQSAESLQELFRKVSLTDPAALGFIISPWSLLLLP
SGSVSFTDENIPNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADHEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGNL
PGTDQLSRNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIHKPPFSHQTFLNKGLSKS
MGFLSIRDTKDEEDYFKDISADNNSGHEDSENTCSPYQFKSSGPHKKVIAGIDMLPKKKI
WASSMDLLCATDKDFSGETDRYQHCHPDAVTGRTSTTPRKKEARYSDGSIALDIFGPQKM
DSVHHIREFSTSSAISSALDRIRDRQKKLQALREAMNVEEPARRYKTYHSDIFNTSSESP
SIISSDSDFRQVRRSEASKRFESNSGLPGVDETPIQGQSQRPSRQYETPLEGNLINQEIM
LKRQEEEMMQLQARMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFF
GPEFVKMTIEPYISLDLPRSILNKKGKNEDNRRKVNIMLLNGQRLELTCDTKTICKDVFD
MVVAHIGLVEHHLFALATLKDNEYFFVESDLKLTKVAPEGWKEEPKKKSKATVNFTLFFR
IKFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETALLLASLALQAEYGDYQPEVH
GVSYFRLEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVH
FHRVHPEKKSQTGILLGVCSKGVLVFEVHNGIRTLVLRFPWRETKKISFSKKKITLQNTS
DGIKHAFQTDNSKVCQYLLHLCSSQHKFQLQMRARQSNQDAHDIERASFRSLNLQAESVR
GFNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNNSKEKSDKASW
EEKPRGMSKSYHDLSQASLYPLRKNVIVNMEPPPQTIVELVGKPFHQMARSDTESLAGFT
KLNSRSVASLNRSPERRKHESDSATEDPGQAYVIGMSMHSSGNSSSQVPLKENDVLHKRW
SIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGVFISSITPGGPADLDGCLKPG
DRLISVNSVSLEGVSHHAAVEILQNAPEDVTLVISQPKEKIPKVPSTPVHFANGMKNYMK
KPSYMQDSAIDSSSEDHHWPLGTLRHIIETSFGLSGGLREESLSSQDSRTESASLSQSQV
NGFFASQLGDRIWQGSQHVSPTPSVITKAIAKKRTSSDSNRSKAKKPGISDVTDYSDRGD
SDMDEATYSSSQDHQTPKKAYFNFHFLESSSSMNTSNKMNFKTFSSSPPKPGDIFEVELA
KNDNSLGISVTGGVNTNVRHGGIYVKAVIPKGAAESDGRIHKGDRVLAVNGISLEGATHK
QAVETLRNTGQVVHLLLEKGQSSASKEHVPVTPQCTLPYQDAQGQTPEKTAKKTTHVKDY
SFVTEENTFEVKLFKNSSGLGFSFSREDNLIPEQMNASIVRVKKLFPGQPAAESGKIDVG
DVILKVNGASLKGLSQQEVISALRGTAPEVSLILCRPPPGVLPEIDTTLLTPLHSSAQGL
PNNSKDPSQPSYVEQGTGSDDNETSDKNRKQCKSPSRKDSYSDSSGSGEDDLVKAPSKIP
NTTWMSQAQSQHEAPKSQEDTFCAMFYHPQKIPQKTEFEDSNSPSPLPLDVTTIQSCQPQ
LESASSDSMGKYHTHHSFEPTRQENLTTLKNDLENHFEDFELEVELLITLIKSEKGSLGF
TVTKGNQSIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNMLRAAPKTV
RLVLGRVLELPRMPVLLHLLPDITLTCNKEELGFSLSGGHNSLHQVIYISDINPKSVAAI
EGNLQLMDIIHYVNGISTQGMTLEEANRTLVMSLPSVVLKATRDGHPVIPSSEMSAISIL
KSTQANGHHSVEPSGQPALTSKNSFSKVNGEEITQALHPKGNYSPSQMKESTNLTRSKES
NIQDDDIYDDPQEAEVIQSLLDVVDEEAQNLLNQNYVTRDASVSDTLKTNGKLSEEKAED
TDCDGSPLPED
Download sequence
Identical sequences ENSSTOP00000010230 ENSSTOP00000010230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]