SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011135 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011135
Domain Number 1 Region: 874-1125
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-59
Family Protein kinases, catalytic subunit 0.0000202
Further Details:      
 
Domain Number 2 Region: 564-852
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-48
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 147-280
Classification Level Classification E-value
Superfamily Second domain of FERM 5.13e-16
Family Second domain of FERM 0.0041
Further Details:      
 
Domain Number 4 Region: 421-545
Classification Level Classification E-value
Superfamily SH2 domain 5.6e-16
Family SH2 domain 0.0032
Further Details:      
 
Domain Number 5 Region: 364-425
Classification Level Classification E-value
Superfamily PH domain-like 0.000000553
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011135   Gene: ENSSTOG00000012422   Transcript: ENSSTOT00000012426
Sequence length 1129
Comment pep:novel scaffold:spetri2:JH393502.1:2299846:2354116:-1 gene:ENSSTOG00000012422 transcript:ENSSTOT00000012426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNIKEDCNAMAFCAKMRSSKKAEVNQVAPEPGVEVTFYLPDREPLRLGTGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTITIDDKISLRLHYRMRFYFTNWHGTN
DSEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKVQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSPHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WLHSNDSGNVLSYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKHKKDEEKNKIQ
EEWNNFSYFPEITHIVIKESMVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGNEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGTHKQFKNFQIEVQKGRYSLHGSDRNFPTLEGLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQGDHLGRGTRTHIYSGT
LVDYKDDEGAAEEKRIKVILKVLDPSHRDISLAMAFFEAASMMRQVSHKHIVYLYGVCVR
DVENIMVEEYVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKN
LLLAREGIDSEIGPFIKLSDPGIPVTVLSRQECIERIPWIAPECVEDSKNLSVAADKWSF
GTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFR
AIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGD
NTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFL
PSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKI
GDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCD
SESSPMALFLKMIGPTQGQMTVTRLVNTLKEGKRLPCPPNCPDKVFIFP
Download sequence
Identical sequences ENSSTOP00000011135 ENSSTOP00000011135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]