SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011486 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011486
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-26
Family Third domain of FERM 0.0052
Further Details:      
 
Domain Number 2 Region: 84-180
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-24
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.78e-16
Family First domain of FERM 0.0024
Further Details:      
 
Domain Number 4 Region: 381-430
Classification Level Classification E-value
Superfamily RING/U-box 0.00000424
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011486   Gene: ENSSTOG00000012816   Transcript: ENSSTOT00000012817
Sequence length 445
Comment pep:novel scaffold:spetri2:JH393362.1:2325378:2339936:1 gene:ENSSTOG00000012816 transcript:ENSSTOT00000012817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDAVLMEVEVEAKAXXXXXXXXVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKESLLAGHLQCSPEQAVELS
ALLAQTKFGDYNQNTAKYNYEELCAKELSSAALNSIVAKHKELEGTSQASAEYQVLQIVS
AMENYGIEWHAVRDSEGQKLLIGVGPEGISVCKEDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLISRSDQSPPSSPLKSSDSSMNC
SSCEGFSCQQTRALQEKLRKLKEAMLCMVCCEEDINSTFCPCGHTVCCESCAAQLQSCPV
CRSRVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences ENSSTOP00000011486 ENSSTOP00000011486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]