SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011771 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011771
Domain Number 1 Region: 430-714
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-82
Family Protein kinases, catalytic subunit 0.000000000129
Further Details:      
 
Domain Number 2 Region: 929-1066
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 3.14e-59
Family FAT domain of focal adhesion kinase 0.000000238
Further Details:      
 
Domain Number 3 Region: 153-274
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-39
Family Second domain of FERM 0.000000406
Further Details:      
 
Domain Number 4 Region: 52-151
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.76e-39
Family First domain of FERM 0.00000288
Further Details:      
 
Domain Number 5 Region: 275-383
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-37
Family Third domain of FERM 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011771   Gene: ENSSTOG00000013107   Transcript: ENSSTOT00000013132
Sequence length 1073
Comment pep:novel scaffold:spetri2:JH393280.1:10426255:10577376:1 gene:ENSSTOG00000013107 transcript:ENSSTOT00000013132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLKKNFFLLTEYDRYLASSKIMAAAYLDPNLNHTPHSSAKTHLGPGMERSPGAMERVLKV
FHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHRVKHVACYGFRLSHLRSEEVHWLH
VDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEI
ADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKT
LRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEG
ISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLSIAEN
MADLIDGYCRLVSGATQSFIIRPQREGERALPSIPKLANSEKQGVRTHAVSVSETDDYAE
IIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPALAVAIKTCKNC
TSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLD
LASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKA
SKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGE
RLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQA
TVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQSNHYQVSGYPGPHGLTAMAGS
IYPGPASLLDQSESWNHRPQEIPLWQPNMEDSTSLDLRGMGQVLPAHLMEERLIRQQQEM
EEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPTGNQHIYQPVGKPDPAAPPKKPPRP
GAPGHLGSLASLSSPGDSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMS
SKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLGELIS
KMRLAQQCAMTSLQQEYKKQMLTAAHALAVDAKNLLDAIDQARLKMLGQARPH
Download sequence
Identical sequences ENSSTOP00000011771 ENSSTOP00000011771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]