SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011800 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011800
Domain Number 1 Region: 840-1142
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.2e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000129
Further Details:      
 
Domain Number 2 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-29
Family Second domain of FERM 0.00039
Further Details:      
 
Domain Number 3 Region: 215-310
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-28
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-18
Family First domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011800   Gene: ENSSTOG00000013120   Transcript: ENSSTOT00000013164
Sequence length 1146
Comment pep:novel scaffold:spetri2:JH393298.1:15923812:15995142:-1 gene:ENSSTOG00000013120 transcript:ENSSTOT00000013164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
VTYFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTVYFGVVFYVPSVLQLQQEITRYQY
YLQLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEKV
LEEATQKVALLHQKYRGLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDIAIGACLEG
IFVKHKNGRPPVIFRWQDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRLCVAR
HKFYRLNQCNLFSFKCSILNSTKKSLSLAINLPYPQPFGLLCPPSPLTVLNSSHLFPPSA
LSIDNLFVPNQNGYYCHSQTSLDRAQIDLNGRIRNGSVYSAHSTNSLNNPQAYLQPSPMS
SNPSISGSDVMRPDYIPTHRHSALIPPSYRPTPDYETVMKQLNRGLVHAERQSHSLRNLN
IGSSYAYSRPDALVYSQPEIREHSHFASPQSAHYPFNLNYSFHSQSPYPYPAERRPVVGA
VSVPELTNVQLQAQDYPAPNIMKTQVYRPPPPYPYPRPANSTPDLSRHLYISSSNPDLIT
RRVHHSVQTFQEDSLPVAHSLQEVSEPLTAARHAQLQKRNSIEIAGLTHGLEGLRLKERT
MSASAADVAPRTLATGPQPGVFAERTKTDEPEEQESGRYGHKKSLSDATMLIHSSEEEEE
LEEDGARALLARPEPRPEPRQPAAEGGHVHATVEARRPRRDGLLTPSMSESDLTTSGRYR
ARRDSLKKRPVSDLLSGKKNTVQGLPPLGGMKKTRVDTKKIGPLKLAALNGLSLSRLPLP
DEGKEVSTRATNDERCKILEQRLEQGMVFTEYERILKKRLVDGECSIARLPENAERNRFQ
DVLPYDDARVELVPTKENNTGYINASHIKVSVSGIEWDYIATQGPLQNTCQDFWQMVWEQ
GIAIIAMVTAEEEGGREKSFRYWPRLGSRHNTVTYGRFKITTRFRTDSGCYATTGLKMKH
LLTGQERTVWHLQYTDWPEHGCPEDLKGFLSYLEEIQSVRRHTNSTSEPKSPNPPLLVHC
SAGVGRTGVVILSEIMIACLEHNEVLDIPRVLDMLRQQRMMLVQTLCQYTFVYRVLIQFL
KSSRLI
Download sequence
Identical sequences ENSSTOP00000011800 ENSSTOP00000011800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]