SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012789 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012789
Domain Number 1 Region: 381-473
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-19
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 
Domain Number 2 Region: 571-659
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-17
Family Third domain of FERM 0.0042
Further Details:      
 
Domain Number 3 Region: 271-322
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000864
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 4 Region: 486-570
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000576
Family Second domain of FERM 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000012789
Domain Number - Region: 18-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0111
Family Ubiquitin-related 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012789   Gene: ENSSTOG00000014271   Transcript: ENSSTOT00000014279
Sequence length 684
Comment pep:novel scaffold:spetri2:JH393409.1:4975776:4988661:-1 gene:ENSSTOG00000014271 transcript:ENSSTOT00000014279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMAGMKTATGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEEINRKQD
WSDHAIWWEQKRRWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLHASFSK
PLFQTVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKGLEEEVFDLTKVVLAGGEQGPGT
GWGRAAHEAHTRGVAPTLFRGMPAHFSDSEQTEACYRMLSRPQPPPDPLLLQRLPRPSSL
SDKTQLHGRWLDSSRCLMQQGISAGDTLWLRFKYYSFFDLDPKADPVRLTQLYEQARWDL
LLEEIDCTEEEMMVFAALQYHINKLSQSGEVGELPSADQGLDDLDAALSNLEVKLEGSAP
TDVLDSLTTIPELKDYLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLN
LKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYAHWMAGCRLASKGRTMAD
SSYASEVQAILAFLSLQRAGGGGSGNQPQGSDASAEGLNPYGLVAPRFQRKFKAKQLTPR
ILEAHQNVAQLSLTEALLRFIQAWQSLPDFGISYVLVRFKGSRRDEILGIANNRLIRIDL
AVGDVVKTWRFSNMRQWNVNWDIQQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLST
RERARGEELDEDLFLQLTGGHEAF
Download sequence
Identical sequences ENSSTOP00000012789 ENSSTOP00000012789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]