SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013463 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013463
Domain Number 1 Region: 1189-1938
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.35e-265
Family Motor proteins 0.000000000172
Further Details:      
 
Domain Number 2 Region: 2857-2940
Classification Level Classification E-value
Superfamily SH3-domain 0.000000122
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 3 Region: 3287-3403
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000478
Family Second domain of FERM 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000013463
Domain Number - Region: 3404-3454
Classification Level Classification E-value
Superfamily PH domain-like 0.00184
Family Third domain of FERM 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013463   Gene: ENSSTOG00000014983   Transcript: ENSSTOT00000015026
Sequence length 3519
Comment pep:novel scaffold:spetri2:JH393551.1:1677078:1723891:1 gene:ENSSTOG00000014983 transcript:ENSSTOT00000015026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDEEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFFWGLH
TGPQKTKRKKKARTVLKSTSKLMTQMRMGKKKRAMKGKKPSFMVIRFPGRRGYGRLRPRA
RSLSKASTAINWLTKKFLLKKAEESGSEQATLDAWLQRSGSRVGSRKLPFPSGAEILRPG
GRLRRFPRSHSIYSSGEPVGFLPFEDEAPFRGSGSRKSLYGLEGFQDLGEYYDYHREGDD
YYDQQSLYHYEEQEPYLAGYRPYSPTWQPYGEHFYGYPPEDPYDYYHPDYYSGSFYPGYG
YGYDDYEPPYAPPSGYSSPYSYHDGFEGEAYPYSHYLDPYAPYDMPYPPYDLPYDTPYPA
PYFDPYGVPYTVPYAEDIYGGGDEAIYAPEVPYLYPEEPSFAYPWVPPPILSPHNPYAHP
MDDIVELEEPEEAGEERQSTSFRLPSAAFFEQQGMDKPARSKLSLIRKFRLFPRPQVKLF
GKEKLEVPLPPSLDIPLGDADEEEEEEEMPPVPTVPYAHPYWGFLTPRQRNLQRALSAFG
AHRGLSFNPDLGRPPPRPATSLARFLKKTLSEKKPIPRLRGSQKARGASPAVREAAYKRF
GYKLAGMDPDRPNTPIVLRRTQPRAQNNNNSHRPPSPAPTPRILSHWSKLVSPSASRRPP
SPGPPPAPPFSPTLSGLPRPASPYGSLRRHPPPWAAPAHVPRAPQANWWAFVEPPPVSPE
VPLDLLAFPVPRPSFRGSRHRGSAFGFPGASPVAPRRRAWSPLPSPQPSLRNLPGLGYRS
PLGPLSPQLSLRRGPFQPPFPPPPHRPGSLREPPKPRQRPASGRLGPPRSPVLGSPRLPP
LPPLLGRGPRHRSLNLPSRLPHTWRRLSEPPTRAVKPQVRRPFHLPPRARTWRAAAGSQE
HQESQHEPEDSETPWIVPPLDPSWDIDVPPTQRPPSPWPGSVGSLRGFSRPPPVPENPFL
QHVGPVSSAAAQPEGPASNATSIFLGRHHDPGPGQLTKSAGPGPENPEEAATPGEPQPSA
ESKTLTLTPPKDAPAEHKALRLSLSYPLAMCDQTRATGPLWHRSRTLPRPLAPLAPTGAP
GPLPKEGERPQPRSGRFAVVLPQVRKLSSFQQGRPAALQPPQQLAQDPQHGPELRACGLR
WSRLWLPAAARRPWPRVQAQPQSHRLGLGAACLSLRGPWKENGPQNCQNKMHSIRNLPSV
RSNEQRREDGVEDMTQLEDLQETTVLSNLKTRFERNLIYTYIGSILVSVNPYRMFGIYGP
DQVQQYHGRALGENPPHLFAIANLAFAKMLDAKQNQCIIISGESGSGKTEATKLILRYLA
AMNQKRDVMQQVEILEATPLLESFGNAKTVRNDNSSRFGKFVEIFLEGGVISGAITSQYL
LEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEITGKSDAD
DFRRLLAAMEVLGFSGEDQDSIFRILASILHLGNVYFEKYETDAQEVASVVSAREIQAVA
ELLQISPEGLQKAITFKVTETMREKIFTPLTVESAVDARDAIAKVLYALLFGWLIARVNA
LVSPQQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQI
DWREITFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPK
MPLPEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVRSRTRVVAHLFSSHAPQAAPQ
RLGKSSSVTRLYKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVVM
AQLRYSGVLETVRIRKEGFPVRLPFQMFVDRYRCLVALKPDLPANGDMCVSVLSRLCTVM
PNMYRVGVSKLFLKEHLHQLLESMREHVLHLAALTLQRCFRGFLVQRRFRSLRRKIILLQ
SRARGYLARQRYQQMRRSLMKFRSLVHAYMNRRRYLKLRAERRRRVEKARLREQEELSKR
EVVAVGHLEVPAELAGLMQALAGLRLARVPCVAPVRTPRLQAEPRVKLPLDINNYPMAKF
VRCHFKEPAFGMLTVPLRMPLTQLPAEYHAEAVSTFKLILRFMGDPHLHGAQEDVLGNYI
VQKGLTIPELRDEILAQLANQVWHNHNAHNAERGWLLLAACLSGFAPSSRLDKFLLKFVS
DYGQNGFQAVCQHRLMQAMGRAQQQGSGAARTFPPTQLEWITTHEKANMALDVSCFNGDQ
FSCPVHSWSTGEEVAGDILRHRGLAEGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLELL
RDFPRQKSYFIVGTEGPMAGRGCPRMVFGNSWDSDEDTPPRPQPQHPMPEVPDSDGYSSH
NEDGTSGETEAQRETVTHQDSDSLGEPAVPHKGLDCYLDSLFNPVLSYGDADLEKPTAIA
YRMKGGGQPGGGSSSGPEDTLRRPPEPKPKPIPGLDASTLALQQAFIHKQAVLLAREMTL
QAMALQQQPLSPALRPLPPEKPLAPEPQPKSVGTGPPAKPVLLRSTPKSAAPAPSAKVPR
PPTKPVAVPILAQGLASPQIASPSQDLVRYSTLNSEHFPQPTQQIRSIIRQCQQPPQGGR
PEALSRKDGRVFVKRPDPHEEALMLLKGQMTHLGTAPGTQVSRETVALVKPVTSAPRPSM
GPTPVQPSRSLEPPEEPVQTRLHCLINPSFYSYQDAPWRIFLRKEVFYPKDSYNHPVQLD
LLFRQILHDTFSAACLRITEDERLRMKALFAQNQLDIQRPLVTESVKRAVISTARDSWEV
YFSRLFPATGSVGTGVQILAVSHTGIKLLRMVKGSREASGQLQVLRTYSFADILFVTMPS
QNMLEFNLASEKVILFSARAPQVKTMVDDFILELKKDSDYVVAVRNFLPEDPALLAFHKG
DIIHLQPLEPPRTGYSAGCVVRKKVVYLEELRHRGPDFGWRFGTIHGRVGRFPSELVQPA
AAPDFLQLPAEPGRSRAAAVAAAVASTAAAQEVGRRREGPSVRAHSADRGEDTLALPPYT
MLEFAQKYFRDPRRQSQDGLRLKSKEGRESRTLEDMLCFTKTPLQESLIELSDTSLNKMA
TDMFLAVMRFMGDAPLKGQNELDLLCTLLKLCEDHEVMRDECYCQIVKQITDNTSSKQDS
CQRGWRLLYIVAAYHSCSDVLYPHLHHFLQHVSRTPGLPFQGIAKACEQNLKKTLRFGGR
LELPSSMELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICSEMALTRPEAF
NEYVIFVVTNRGQHVCPLSRRAYILDVASEMEQVDGGYMLWFRRVLWDQPLKFENELYVT
MHYNQVLPDYLKGLFSSVPASRPMEQQLQQVSKLASLQHRAKDHFYLPSVREVQEYIPAQ
LYHTTAGSAWLNLVSQHRPQTQALSPHQARAQFLGLLSAFPMFGSSFFFIQSCSNVSVPA
PCILAVNHNGLNFLSIETHELIVKFPLKEIQSTRTQRPTANSSYPYVEIALGDVAAQRTM
QLQLEQGLELCRVVAVHVENLLSAREKRLTLPPSEITLL
Download sequence
Identical sequences ENSSTOP00000015919 ENSSTOP00000013463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]