SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013756 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013756
Domain Number 1 Region: 39-803
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.96e-276
Family Motor proteins 0.000000000173
Further Details:      
 
Domain Number 2 Region: 1883-1999
Classification Level Classification E-value
Superfamily Second domain of FERM 7.59e-21
Family Second domain of FERM 0.0053
Further Details:      
 
Domain Number 3 Region: 2000-2089
Classification Level Classification E-value
Superfamily PH domain-like 1.95e-19
Family Third domain of FERM 0.017
Further Details:      
 
Domain Number 4 Region: 1184-1286
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000224
Family Ubiquitin-related 0.071
Further Details:      
 
Domain Number 5 Region: 1783-1891
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000992
Family Ras-binding domain, RBD 0.041
Further Details:      
 
Domain Number 6 Region: 1278-1371
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000126
Family Second domain of FERM 0.0063
Further Details:      
 
Domain Number 7 Region: 1497-1563
Classification Level Classification E-value
Superfamily SH3-domain 0.000000162
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 8 Region: 810-873
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000191
Family Motor proteins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013756   Gene: ENSSTOG00000015334   Transcript: ENSSTOT00000015359
Sequence length 2107
Comment pep:novel scaffold:spetri2:JH393279.1:43666063:43726290:-1 gene:ENSSTOG00000015334 transcript:ENSSTOT00000015359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDHVWLEPASTNKTEVAIGGIIKETKPGKVLVEDDEGKEHWIQAEDFGVLSPMHPNSVEG
VDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQMLPLYTLEQVQLYYGRH
VGELPPHVFAIANSCYFSMKKNKKDQCCVISGESGAGKTETTKLILQFLATISGQHSWIE
QQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNTSGVIEGARIEQFLLEKSRVCRQA
AEERNYHIFYCMLMGMSVEEKKLLGLGMPSEYHYLTMGNCTSYEGLNDAKDYAHVRSAMK
ILLFSDSENWDISKLLAAILHLGNVEFMAAVFENLDSSDVMETPAFPIMMNLLEVQYQAL
RDCLIKHTILIRGEYVTRPLNIAQAADRRDAFVKGIYGHLFLWIVKKINAAIFPPPAQDP
KNVRRAIGLLDIFGFENFQNNSFEQLCINFANEHLQQFFVQHVFTMEQEEYRSENISWDY
IHYTDNRPTLDLLALKPMSVISLLDEESRLPQGTDITMLQKLNSVHANNKAFLKPKNIHD
ARFGIAHFAGEVYYQAEGFLEKNRDMLSADILTLVYSSKNKFLREIFNLESAETKLGHGT
IRQAKTRNQFFKGTDSTKRPSTLASQFKQSLDQLMKILTNCQPYFIRCIKPNEYKKPLLF
DRKLCIQQLRYSGMMETVHIRKSGFPIRYTFEEFSKRFRVLLPSAERKPLQDKFRQMTLC
ITEVCLGTDKEWRVGKTKIFLKDHQDTLLEIQRSQALDEAAIRIQRVMRGYKYRKEFLRQ
RRAAVTLQAEWRGYCSRKNFKLILVGFERLQAIARSHLLMRQFQATRQRMVQLQARCRGY
LVRQQIQAKRRAIVTIQAHARGMAARRSFQRRKAKGPLVIPVKEQESENVLPSKKRKSIY
DTVTDTEMVEKVFGFLPSMIGGQEGQAPTGFEDLEVKTQKKLPEIDLDTVPMLKEPEEDV
DGLAEYTFPKFAVTYFQKSATHTHIQRPLRYPLLYHEDDTDYSAALAVWNIILRFMGDLP
EPMLYAKNSLSGSPVMQQIHNTLDKENGPRPSLGFKVASQLNIGEEPFDLDGPISERPMS
NLEKVHFIVGYAILRPGLRDEIYCQICKQLSGNSRKSSTARGWILLSLCLGCFPPSERFM
KYLLNFIGQGPAGYGPFCAERLRRTYANGVRAEPPTWLELQAVKSKKHIPIQVILVTGES
LAVMVDSASTSREICQHIAQKKGLRDYLGFSLQVAVYDKFWSLGSGRDHVMDAVAQCEQL
AQEKGASQRQSPWRIYFRKEFFTPWHDSQEDPVSTELIYRQVLHGVWSGEYSFEKEEELV
ELLARHCYVQLGASLRGRAVQELLPGCVPSKLYKTKPPEKWASLVTDAHTKAPYTQTRAT
TLAVQEQVVDTALLQWPLLFSRLFEVTTLSGPRLPKTQLILAVNWKGLYFLDQRERKLLE
LSFPEIMGLVTNREAKGGQRLLLSTLHEEYEFVSPSCVAIAELVALFLEGLKERSVFAMA
LQDRKATDDVTLLPFKKGDLIILTKKQALLVSESWTLGQNDRTGKTGLVPTACLYTIPTL
SKPSSQLLSLLAMSPEKRKLAAQEKQSSEPLPEEQPKEKLHTLEDFSYEFFRTPEKETVS
RAMMPLARTRGHLWAYSLEPLRQPLLKRVHDRADLRDAACQIFQAILKYMGDYPSRQAWP
TLELTDQIFSLPLQDSALQDEVYCQILKQLTQNSNRYSEERGWQLLWLCTGLFPPGKALL
PHAQKFLDTRRKKLLAPDCSRHIQKVLRTGPRKQPPHQVEVEAAEQNVSRLCHKIYFPND
TNEMLEVGANTRVRDVCESIATRLQLASWEGCSLFIKISDKVISQKEGDFFFDSLRHMSD
WVKKNKPQKEGAPVTLPYQVYFMRKLWINVAPGKDVNADTILHYHQELPKYLRGFHKCSR
EDAVHLAGLIYKAQFDNDRSQLASIPKILRELVPENLTRLMSSEEWKKSLLVECDKHKDK
TVQEAKVAFLKWICRWPTFGSAFFEVKQTSEPSYPDIVLIAINRHGVLLIHPKTKDLLTT
YPFTKISNWSSGSTYFHMALGSLGRGTRLLCETSLGYKMDDLLTSYVQQLLSAVNKQRGP
RAPSLAS
Download sequence
Identical sequences ENSSTOP00000013756 ENSSTOP00000013756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]