SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014134 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014134
Domain Number 1 Region: 564-652
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-19
Family Third domain of FERM 0.0044
Further Details:      
 
Domain Number 2 Region: 378-471
Classification Level Classification E-value
Superfamily PH domain-like 9.75e-17
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 277-320
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000017
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000014134
Domain Number - Region: 513-563
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000301
Family Second domain of FERM 0.0059
Further Details:      
 
Domain Number - Region: 16-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0113
Family Ras-binding domain, RBD 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014134   Gene: ENSSTOG00000015791   Transcript: ENSSTOT00000015793
Sequence length 675
Comment pep:novel scaffold:spetri2:JH393295.1:12985552:13016906:1 gene:ENSSTOG00000015791 transcript:ENSSTOT00000015793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSSDFASASWELMVQVHNPNEKEPRDITLRVSGDLHVGGVMLKLVEKINIAQDWSDFA
LWWEQKHCWLLKTHWTLDKCGVQADAKLLFTPQHKMLRLRLPNMKTVRLRVSFSAVVFKA
VSDICKSLNIRRSEELSLLKPSGDFFKKKKKKDKNNKEPIIEDILNLESSPTGSPGSPGL
YSKTMTPTYDPVNGTPASSTITWFTDSPLTEQNCNILAFSQPPPLPEALADMYQPRSLID
KAKLNSGYLIFNPSIIPSEFTDQLGLPLHYSTYSFFTTHRKYDAVRINQLYEQARWAILL
EEIDCTEEEMLIFAALQALIMGVIFRLITFNQKGGSIVIGYSFTLGSLIVKCFNRKVVSF
LEDITDIPKLADNLKLFRPKKLLLKAFKQYWFVFKDTSITYFKNAELEQGEPIEKLNLRG
CEVAPDVNVAGRKFGIKLLIPVADGMNEVYLRCDHENQYAQWMAACILASKGKTMADSSY
QPEVLNILSFLRMKNRKSSIQLTSSLESMDMNPECFVSPRCAKKHKSKQLAARIMEAHQN
VATMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIRIDATTGIPIT
TWRFTNIKQWNVNWEIRQVMIEFDQNFQVAFTCLSADCKIVHEYIGGYIFLSTRSKDQNE
TLDEDLFHKLTGGQD
Download sequence
Identical sequences ENSSTOP00000014134 ENSSTOP00000014134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]