SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014186 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014186
Domain Number 1 Region: 66-129
Classification Level Classification E-value
Superfamily BPTI-like 2.27e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 2 Region: 31-71
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000445
Family Elafin-like 0.0027
Further Details:      
 
Domain Number 3 Region: 130-172
Classification Level Classification E-value
Superfamily Elafin-like 0.000000471
Family Elafin-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014186   Gene: ENSSTOG00000015851   Transcript: ENSSTOT00000015848
Sequence length 180
Comment pep:novel scaffold:spetri2:JH393324.1:7387348:7396505:1 gene:ENSSTOG00000015851 transcript:ENSSTOT00000015848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGGLLRVLVLFILFVTVQGPGLSDRFFPKKCPRIREQCEFRERDLCTKDRQCPHNQKC
CVFNCGRKCLDLQQDICTLPKESGPCMALFRRWWYSKNNNTCYGFVYGGCQGNNNNFQTK
SICQNACQQKTESCPKVRVKCEIEERNLCTRHRQCPNNMKCCMFSCGKKCLDMRKGTYDP
Download sequence
Identical sequences ENSSTOP00000014186 ENSSTOP00000014186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]