SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014309 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014309
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-39
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 7.59e-36
Family Second domain of FERM 0.0000686
Further Details:      
 
Domain Number 3 Region: 40-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-24
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014309   Gene: ENSSTOG00000015989   Transcript: ENSSTOT00000015990
Sequence length 732
Comment pep:novel scaffold:spetri2:JH393279.1:50333450:50436299:-1 gene:ENSSTOG00000015989 transcript:ENSSTOT00000015990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFLRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQLAAYNLQAELGDYDFAEHS
PELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRMDFKKNKITLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQTTKTSK
ARRSTSFERRPSKRYSRRTLPMKASTAKSEELSVHNNVSTQSNDSQQTWGLRSTASVIPS
TSSGPVLVEIENLPKNSGTDQHDKKCLPLSIDLLDSPDLLETAIGDVTRASDTMETSLAL
DDINIATMQTGLEEPEAESETLKDASEKLKQFEMENSPLLSPQSNIDINVNSQKEVVKLT
EKCLNNAIESPALNAMRVPPDFKSNILKAQVEAVHKVTREDSLLSHKNASVQDATTDSVV
LNENNVFLSKDSLAPMCTMPADSNSVLKDATDELDALLLSLTENLIEPTVTPQVSSTSMI
TPRWIVPQSGAISNGLGRYGTLLAGKEGHGNKDEISLISPPAPFLVDAVTSSAPTLVEDT
VLKQKCLLTTEL
Download sequence
Identical sequences I3MQQ5
ENSSTOP00000014309 ENSSTOP00000014309 XP_005315969.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]