SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015940 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015940
Domain Number 1 Region: 22-115
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-35
Family V set domains (antibody variable domain-like) 0.000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015940   Gene: ENSSTOG00000020622   Transcript: ENSSTOT00000025491
Sequence length 117
Comment pep:novel scaffold:spetri2:JH393983.1:145768:146237:-1 gene:ENSSTOG00000020622 transcript:ENSSTOT00000025491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPVQLLGLLLLCLPGAKCDITMTQSPTTLSKSQGETVTIRCQASQGISNYLSWYQQKP
GQAPKPLIYYTNRLHSGVPSRFSGSGSGTDYSLTITSLEPEDVADYFCLQSYSSPPT
Download sequence
Identical sequences ENSSTOP00000015940 ENSSTOP00000015940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]