SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016744 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016744
Domain Number 1 Region: 11-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000785
Family Ras-binding domain, RBD 0.054
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000016744
Domain Number - Region: 100-121
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0356
Family Second domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016744   Gene: ENSSTOG00000023778   Transcript: ENSSTOT00000022898
Sequence length 128
Comment pep:novel scaffold:spetri2:JH393309.1:7194093:7199189:-1 gene:ENSSTOG00000023778 transcript:ENSSTOT00000022898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQDRLSLRYIEHFALVLEYA
GPEQSHKFLLLQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQV
EYGLGYRQ
Download sequence
Identical sequences ENSSTOP00000016744 ENSSTOP00000016744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]