SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017028 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017028
Domain Number 1 Region: 78-125
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000157
Family Elafin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 31-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000000122
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017028   Gene: ENSSTOG00000020680   Transcript: ENSSTOT00000026756
Sequence length 134
Comment pep:novel scaffold:spetri2:JH393288.1:19919192:19920920:-1 gene:ENSSTOG00000020680 transcript:ENSSTOT00000026756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLISLALGLLALKAVLAQDPTFISPVQVMCPERSSSKEMPCTPACLTDEDCLGNTKCC
PSACGLSCRTPIIEAAPKAGSCPWVDNQISQLCQEEDHCSHDSECDGDKKCCMSDCARKC
LDPVQAHPSLRRMV
Download sequence
Identical sequences ENSSTOP00000017028 ENSSTOP00000017028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]