SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017383 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017383
Domain Number 1 Region: 405-542
Classification Level Classification E-value
Superfamily TIMP-like 6.51e-24
Family Netrin-like domain (NTR/C345C module) 0.01
Further Details:      
 
Domain Number 2 Region: 184-280
Classification Level Classification E-value
Superfamily Immunoglobulin 2.63e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 356-412
Classification Level Classification E-value
Superfamily BPTI-like 2.7e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0025
Further Details:      
 
Domain Number 4 Region: 105-155
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000929
Family Ovomucoid domain III-like 0.029
Further Details:      
 
Domain Number 5 Region: 307-352
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000426
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.023
Further Details:      
 
Domain Number 6 Region: 26-73
Classification Level Classification E-value
Superfamily Elafin-like 0.000000196
Family Elafin-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017383   Gene: ENSSTOG00000028457   Transcript: ENSSTOT00000029401
Sequence length 548
Comment pep:novel scaffold:spetri2:JH393311.1:371390:373765:-1 gene:ENSSTOG00000028457 transcript:ENSSTOT00000029401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALQLFLPLFLIIRLALGAGLLPELGNHPGLCPNQLSPSLWVDAQSTCERECTRDQDCA
ASEKCCANVCGLQSCVAARFPDGPDAPTTAASCEGFKCPQQGSDCDIWDGQPVCRCRDRC
EKEPHFTCASDGLTYYNRCYMDAEACLRGLHLHVVPCKHVLSWPPSSPGPPETTARPMLG
AAPMPPVLYNSPSPQAVHVGGTASLHCEVSGRPPPAVTWEKQSHQQENLILRPDQMYGNV
VVTSIGQLVLYNARPEDAGLYTCTARNAAGLLRADFPLSVVQREPARDKAHGVPTLAECL
PGTQACSGPASPHHVLWNFDPQRGGCMTFPALECDGATRGFETYEACQQACTRGPGDACT
LPAVQGPCQGWEPRWAYSPLLQRCLPFLYSGCEGNGNNFESRERCEDACPVPRTPPCRAC
RLRSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALDDVLKDDKMGLKFLGTKYLEV
TLSGMDWACPCPNVSAGDGPLVIMGEVRDGVAVLDPGSYVRAASEKRVKKISELLEKKAC
ELLNRFQD
Download sequence
Identical sequences I3MZ37
ENSSTOP00000017383 ENSSTOP00000017383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]