SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017658 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017658
Domain Number 1 Region: 114-256
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 11-116
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-33
Family Second domain of FERM 0.0000869
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017658   Gene: ENSSTOG00000007019   Transcript: ENSSTOT00000020927
Sequence length 481
Comment pep:novel scaffold:spetri2:JH393281.1:6928882:6971848:-1 gene:ENSSTOG00000007019 transcript:ENSSTOT00000020927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYD
PGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDP
HPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKII
LTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVME
SSAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHS
TPVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQI
NGATCSIEEEKESEASTPTAAEVEALGGELRALCQGHGGPEEEQVNKFVLSVLRLLLVTM
GLLFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYFCPLRRWFACKIRSVVSLLID
T
Download sequence
Identical sequences A0A287D9N8
ENSSTOP00000006273 ENSSTOP00000017658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]