SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017768 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017768
Domain Number 1 Region: 568-600,639-690
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000804
Family Anti-sigma factor antagonist SpoIIaa 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017768   Gene: ENSSTOG00000006553   Transcript: ENSSTOT00000006551
Sequence length 714
Comment pep:novel scaffold:spetri2:JH393314.1:4993479:4997256:-1 gene:ENSSTOG00000006553 transcript:ENSSTOT00000006551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLESKEQHDLSPRDSAEGNDSLPSGVLLKPQKESSTDLKQFETNDRRSSYPRIHMEPQE
KSHTNIKQFVIKKLQKSCQCSPTKVKNMIFDFLPVLRWLPKYDLKKNILGDVMSGLIVGI
LLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFIFGTSHHISVGIFGVLCLMIGEVVDREV
HKAGSDIAPSLEIILNRSTLVNQTLDRVCDKSCYAIKVGSTVTFMAGVYQVAMGFFQVGF
VSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSSGVGSFITTWIHIFRNIHKTNLC
DLITSLLCLLVLLPTKELNERFKSKLKAPIPTELIVVVAATLASHYGKLNENYNSSIAGH
IPTGFMPPQVPDWSLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVRANQEMYAIGF
CNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAVVTALVLLLVLLIIAPLFYSLQKCVL
GVITIVNLRGALCKFRDVPKMWRVSRMDTVIWFVTMLSSALISTEIGLLVGVCFSMFCVI
LRTQKPKISLLGLVEETEIFESISAYKNLQTKPGIKIFRFVAPLYYINKECFRSALYKKT
LNPVLVKAAQKKAAKIKLKEETVTLSGIQDEVSMQLSHDPLELHTIVIDCSTIQFLDTAG
IHTLKEVRRDYEAIGIQVLLAQCNPSVYEAVAFAVESQKQKGICVLNGLSLSGD
Download sequence
Identical sequences ENSSTOP00000017768 ENSSTOP00000017768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]