SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018725 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018725
Domain Number 1 Region: 538-568,660-739
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000169
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018725   Gene: ENSSTOG00000027369   Transcript: ENSSTOT00000021492
Sequence length 756
Comment pep:novel scaffold:spetri2:JH393339.1:426101:433770:-1 gene:ENSSTOG00000027369 transcript:ENSSTOT00000021492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSTLILGPGKNQYVTVYSQIMELQKQDYHVDRPLMNQEQLEELGRWDLTPRTYQWRTWL
KCSHARARALLIQHLPVLGWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPDENFLLDSNSTVNETAR
DVTRVQLASTLSVLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVFVSQLKYVFG
LQLSSHSGPLSLIYIVLEVCWKLPQSVIGTVITALVAGVVLVMVKLLNDKLQRYLPLPIP
GELLTLIGATGISYGVGLKQRFGVDVVGNIPAGLVSPEAPNPQLFVKLVGNAFAIAVVGF
AIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNTQ
VAGAVSSLFILLIILKLGELFQDLPRAVLAATIIVNLKGMLMQFADICSLWKKNRVDLLI
WLVTFVATILLNLDLGLAVALAFSLLLVVVRTQLPHYSVLGQVSDTDIYRDVAEYSDARE
VPGVKIFRSSATIYFANAELYSDTLKQRCGVDVDHLISRKKKLLKKQEMKLKRLQKHKSP
QEQDNSVSINVNTNLGDIKSNDVESSKTKARPENELEEIVASGQEDAKAIAVPTLKALGL
PQPDFHSLILDLGALSFVDTVCIKNLKNIFRDFREIEVDVYIAACHSPVVTQLEAGQFFD
ASITKRHLFVSVHDAVTFALQHSKSGPISPVLATKL
Download sequence
Identical sequences ENSSTOP00000018725 ENSSTOP00000018725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]