SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018892 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018892
Domain Number 1 Region: 82-131
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000209
Family Elafin-like 0.00044
Further Details:      
 
Domain Number 2 Region: 30-77
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000562
Family Elafin-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018892   Gene: ENSSTOG00000020296   Transcript: ENSSTOT00000024433
Sequence length 133
Comment pep:novel scaffold:spetri2:JH393324.1:7618713:7620018:1 gene:ENSSTOG00000020296 transcript:ENSSTOT00000024433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSSLLPLVVLLALGTLAPLAVEGSGNESLKAGACPARPQVRCLRYEEPACQTDWQCPG
KQRCCPDYCGIKCLDPVAIPRPVERKPGKCPVVKAQCMMLNPPNRCETDSQCDRDFKCCL
GMCGKLCLPPVRG
Download sequence
Identical sequences ENSSTOP00000018892 ENSSTOP00000018892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]