SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020153 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020153
Domain Number 1 Region: 46-142,176-243
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.14e-17
Family Myotubularin-like phosphatases 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020153   Gene: ENSSTOG00000026592   Transcript: ENSSTOT00000024409
Sequence length 243
Comment pep:novel scaffold:spetri2:JH393412.1:3489395:3513490:-1 gene:ENSSTOG00000026592 transcript:ENSSTOT00000024409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARAGSSASSGNPPPQEPGLGELLEEFSRTQYRAKDGSGTSGSKVERIEKRCLELFGR
DYCFSVIPNVNGDICGHYPRHIVFLEYESSEKEKDTFQSTVQVSKLQDLINRSKMARCRG
RFVCPVILFKGKHICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSG
DMHLFDKVRGYDIRLLRYLSVKYICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSI
PYP
Download sequence
Identical sequences ENSSTOP00000020153 ENSSTOP00000020153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]