SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020274 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020274
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily POZ domain 2.42e-17
Family BTB/POZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020274   Gene: ENSSTOG00000025199   Transcript: ENSSTOT00000029977
Sequence length 158
Comment pep:novel scaffold:spetri2:JH393347.1:6930702:6946557:-1 gene:ENSSTOG00000025199 transcript:ENSSTOT00000029977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAILSARSSYFAAMLSGCWAESSREYITLQGINHVEMNVMMHFIYGGILDFPDKANVGQI
LNMADMYGLEGLKEVAIYILRRDYCNFFQKPISRTLTSILECLIIAHSVGVESLFADCMK
WIVKHFARFWSERSFANVPPEIQKKCLNMLIQSLVSIN
Download sequence
Identical sequences ENSSTOP00000020274 ENSSTOP00000020274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]