SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021197 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000021197
Domain Number - Region: 57-78
Classification Level Classification E-value
Superfamily Elafin-like 0.0497
Family Elafin-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021197   Gene: ENSSTOG00000024891   Transcript: ENSSTOT00000029352
Sequence length 118
Comment pep:novel scaffold:spetri2:JH393402.1:3106340:3111515:1 gene:ENSSTOG00000024891 transcript:ENSSTOT00000029352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGDASLRKAQHLTSARRAALLLCLGFASFHSACWAEVSSSSHNSTVTTHHPGPGTLEQ
CPNVDFCPQAARCCHAGVDEYGWIAAAVGWSLWFLTLILLCVDKLMKLTPEEPKDSQA
Download sequence
Identical sequences ENSSTOP00000021197 ENSSTOP00000021197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]