SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021214 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021214
Domain Number 1 Region: 149-257
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-26
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 2 Region: 55-149
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000005
Family First domain of FERM 0.016
Further Details:      
 
Domain Number 3 Region: 258-381
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000615
Family Third domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021214   Gene: ENSSTOG00000019365   Transcript: ENSSTOT00000025863
Sequence length 548
Comment pep:novel scaffold:spetri2:JH393299.1:16809672:16830248:1 gene:ENSSTOG00000019365 transcript:ENSSTOT00000025863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEMPPRGGGTPAAHSPWTTRLLSPTGAWPAEAGPERGWDAAQANPGDSKMTSEHRDVLVL
LPAQKQLRLAVGVRATARELFQQVCGVLGLREARFFGLSVVRDNEHVFMDLELRLSKYFS
EDWKRGTQQGGWRPRAPFVTSLRVQYYVENGRVMSDQVARHLYYCSLKERVLRSQCAHRE
EAYFLLAALALQADLGSHRKPPHIGRYFEPQAYFPQWVIAKRGVDYILRHVPTVHREQQE
LSPQAAVLRFIRDACQLEDVPVHFFRLYKDKKREHPTFLLGLTLKGMHIYQGKKLEIQPA
GLPASRKLVFYTGFPWRSRHLLRLLRSSHQFYLSVKPLLQRLQLLDEAEEKKRYQEAYIS
DPLELDPELASRHRRDTGPPHHRRLSLSSADSHGSAHTLGTEADSQHAESGEVSVDEPVA
AEGLCSRKMPSISFRDSGGSKASCSEPFTVVQVPLAGTRGQSTEVLHKVREAEPSAREAL
HGRSLDHMHQLQPAPRPAPASHTCAFSCALAGLLVPQEARAALCGKRSMNCLSLDLLREG
ASLQEFVV
Download sequence
Identical sequences ENSSTOP00000021214 ENSSTOP00000021214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]