SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021323 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021323
Domain Number 1 Region: 23-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.14e-77
Family MHC antigen-recognition domain 0.0000000778
Further Details:      
 
Domain Number 2 Region: 204-296
Classification Level Classification E-value
Superfamily Immunoglobulin 4.92e-30
Family C1 set domains (antibody constant domain-like) 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021323   Gene: ENSSTOG00000023150   Transcript: ENSSTOT00000027310
Sequence length 358
Comment pep:novel scaffold:spetri2:JH393533.1:140168:144802:-1 gene:ENSSTOG00000023150 transcript:ENSSTOT00000027310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRMLFLMLSGALARTETWEGSHSMRYFITAVSRPGGESRFITVGYVDDTQFVRFDSDA
ETPRMEPLAPWIEQEGPEYWERETQKAKGHSQIDLMSLNNLRGYYNQSADGSHTLQRMSG
CDLGTDGRLLRGFEQRAYDGKDYLALNEDLRSWTAADVAAQITRRKWEAAGDAEHHRAYL
EGECVESLTRYLENGKETLLRTDPPKMHVTHHPRPEGDITLRCWALDFYPKEITLTWQRD
GEDQTQDMELVETRPAGDGNFQKWASVEVPAGEEQRYICHVHHEALPEPLTLRWEPPSQP
TIPMVGIVAGVILLGVAVTGAVVAFVLWKKKNTGVKKGPYAPAKGNDSAQDSYVSLTA
Download sequence
Identical sequences ENSSTOP00000021323 ENSSTOP00000021323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]