SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021518 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021518
Domain Number 1 Region: 24-74
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000017
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021518   Gene: ENSSTOG00000023892   Transcript: ENSSTOT00000024628
Sequence length 78
Comment pep:novel scaffold:spetri2:JH393324.1:7650121:7650470:1 gene:ENSSTOG00000023892 transcript:ENSSTOT00000024628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSSLSLLSVAALLWLRVAQANMKEVQQKSGYCPEFFLSCSFTLLPRCRRDGGCNGPKK
CCFYQCQQQCMQPWPTLD
Download sequence
Identical sequences I3NAX1
ENSSTOP00000021518 XP_021582132.1.77405 XP_021582133.1.77405 ENSSTOP00000021518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]