SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021599 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021599
Domain Number 1 Region: 115-158
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000366
Family Elafin-like 0.0015
Further Details:      
 
Domain Number 2 Region: 318-404,707-787
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000154
Family Fibronectin type III 0.0064
Further Details:      
 
Domain Number 3 Region: 514-555,909-954
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000104
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 264-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021599   Gene: ENSSTOG00000027158   Transcript: ENSSTOT00000020390
Sequence length 1331
Comment pep:novel scaffold:spetri2:JH393310.1:1730243:1785720:-1 gene:ENSSTOG00000027158 transcript:ENSSTOT00000020390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTPMTLGLALLALASAVGLSQASSFTEKGLSLLSYQLCSYLETRSVPRVEAVQTSHVVHT
SCGGWIPWRWCPKTVYRTQYLTVEVPESRNVTDCCKGYEQLGLYCVLSLNRSGEFASRPG
VCPTAGPQLPTSQCSSDTECPGLQKCCPWSGGHHCVAPTPHDAGAAPERSRVSWYNVTML
VKVDFVDLQHVDPGLQNHTRLLCSLVTSALQLLDPAVHYLSSARQDPSTTLSWLLLGLPQ
LLPVAKVSSMLNDIVKRVYEVVSIQVQDVDECSHHGLHACSGEELCVNGEGSYQCVCPQD
SSASAPQKLNGTGKDCPPIRDYVALNVTSSSFRVSWGLNSTQNHTFHVQLQRGELVLRRA
WTSDLGLEVAGLEAGVLYGVKTSYQGCGANVSAWLTVKTDAQVFGLTIRIVNCNLTEQVL
NYSSVEHRDFSRQLLQEVENSFPPAVCDLYRRGKLRMQMASLQVGSVVVKLRLTVQDPEF
PVGVSTLAPLLQLLPSSTVFQIDQQGTAVQDWDECADSSEHDCSPAADCINLEGSYTCQC
RTARDANPSRAGRACEGDVVRPTGGELSAATGVTASALGTGTTTLSLRPRHPWDTLAASQ
AQTPRPPPRRGGSGTVGNNRNSTGGPGPTHVSPQGDTDSPLDPPGQLWGSPTMDPLFWPV
PAEDPTGHSVWHTNLPTQKTSLNATRLQDKDPGPSPWIDLVSTPIPAPLEPPACAPVPIQ
RVTVSNVTSTSFHLAWVANLTLHPTFRLSLASPRSPAVGLETRDTSMTVSGLEPGILHLV
EIVAKVCGEEGARAHLKVRTAAQKLSGKVRLANVRFSESLCDSSSTEHQRFLGLFFRRVR
DPLPATLRRHMDSGGIRVDVTSIANGSVVVEFDLLVTADLDVREVSVAFLCALQNASLLG
ASRDSASIWDYDECERQEDDCAPGTSCRNTLGSFTCSCQGGAPDFHVEYSGRPCEGSSPG
NLTQAPSPEQLPTPAGTRAALRTGDRPTPQDLRPRLNLTGAVRVLCEIEKVAIAIQRRFL
QQEAIPESSLYLGQPSCNVSSSNSTHVLLVAGWGECGTLVQSNVTNTVVRTMLRNDLSPE
GIIHHPKILSPIHCAFQNDLLTSLGYAPEWGVHTILEDLHGAGNFVTEMQLFIGDSPIPP
NHSVSASEDITIEVGLCRQNSKLKVVLTECWATPSSNARDPVTFSFINNSCPVPNTYTSV
IENGNSSKAQFKLRIFSFINNSVVYLHCRLRVCVESPRATCKISCNDFRSPRRSRGSEVQ
QMSWGPLVRAQGASPGAKPGLGTGHVVLIAVACLVMVAGAAAFLIMRYQKLTGKYNFSTQ
ADNFSYQVFSE
Download sequence
Identical sequences ENSSTOP00000021599 ENSSTOP00000021599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]