SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022198 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022198
Domain Number 1 Region: 27-73
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000785
Family Elafin-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022198   Gene: ENSSTOG00000027286   Transcript: ENSSTOT00000020697
Sequence length 76
Comment pep:novel scaffold:spetri2:JH393300.1:460628:461437:1 gene:ENSSTOG00000027286 transcript:ENSSTOT00000020697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AATVLVLVGFVTLGMNMVCARNYFPSQELQDYGECPELPEGTYATCAEMCSGDDSCPMGM
KCCSNGCGHTCQKAVF
Download sequence
Identical sequences ENSSTOP00000022198 ENSSTOP00000022198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]