SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000015 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000015
Domain Number 1 Region: 223-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.84e-51
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 63-177
Classification Level Classification E-value
Superfamily POZ domain 6.54e-28
Family Tetramerization domain of potassium channels 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000015   Gene: ENSSTOG00000000015   Transcript: ENSSTOT00000000015
Sequence length 514
Comment pep:novel scaffold:spetri2:JH393324.1:3792364:3797593:1 gene:ENSSTOG00000000015 transcript:ENSSTOT00000000015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLPGDNSDYDYSALSCTSDASFHPAFLPQSQSLKGVFYRRAQRLRPQDGPCPGGPAGD
RRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCRRRYLQKIEEFAEMV
EQEDEEDPLDSEGRDSEGPARAEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGQCSQMCRNVFIVESVCVGWFSLEFLLRFIQAPSKFAFLRSP
LTLIDLVAILPYYVTLLVDGAASGRRKPGNSNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
RAQFLIKTKSQLSGMSQDSDILFGSASSDTRDNN
Download sequence
Identical sequences I3LVU3
XP_005325269.1.77405 ENSSTOP00000000015 ENSSTOP00000000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]