SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000344 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000344
Domain Number 1 Region: 128-330
Classification Level Classification E-value
Superfamily Fibronectin type III 8.11e-24
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 388-600
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000478
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 3 Region: 75-122
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000034
Family Elafin-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000344   Gene: ENSSTOG00000000380   Transcript: ENSSTOT00000000381
Sequence length 626
Comment pep:novel scaffold:spetri2:JH393454.1:723506:837427:1 gene:ENSSTOG00000000380 transcript:ENSSTOT00000000381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLNGSNLSFLFFFLQNNGSLVWCQNHKQCSKCLEPCKEPGDLRKHQCQSFCEPLFPKKNY
ECLTSCEFLQYVLLVKQGDCPAPERASGFAAACVESCDVDLECSGVKKCCSNGCGHTCQV
PKTLYKGVPLKPRKELRFTEHQSGQLEVKWSSKFNVSIEPVIYVVQRRWNHGIHPSEDDA
TQWQTVAQTTDERVQMTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPA
NLQLANSTVNSDGTVTVTIAWDLPEEPDIPVHHYKVFWSWTVSNKSLVPTKKKRRKTTDG
LQNFVVLERLQPDYDYTVELQAITYWGQTRLKSAKVSLRFTSPHPTSYKEQVGKPSKAGI
QTQPPFQRRRPPRPLEIGAPFYQDNRLQVKVYWKKTEDPSINRYHVQWFPEVCAHNQTAG
SETSSAVTHENHIILQDLSFSCKYKVSVQPLRPKSHSKAETIFFSTPPCSALKGKSHKHV
NCPGDAGPVGSKVLAKPENLSASFVVQDVNITGHFSWKMTKAHLYQPMTGFQVTWAEVTT
ESRQNSLPNSIISQSQILPSDHHVLTVPNLRPSTLYRLEVQVLTTGGEGPATIKTFRTPG
LPPSAAHRPHLKHPHLHHYKPSPERY
Download sequence
Identical sequences ENSSTOP00000000344 ENSSTOP00000000344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]